DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and CG2839

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster


Alignment Length:280 Identity:99/280 - (35%)
Similarity:161/280 - (57%) Gaps:24/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFQHANFFLHVFMACGLYGIRAK-DVC--PRMST-DK-----EVCLVELAPVLKYISNNHKSHWN 56
            ||:.|.:||.||.:.|...:.|: |:.  |.:|: |:     |:||:::.|:|:.||...|..: 
  Fly     1 MFECATYFLFVFFSYGSCNVFAENDILQDPLISSYDRLKKLGEMCLIDILPILENISEQQKEGY- 64

  Fly    57 SANEVQVNETRKQLAKIEGQEKETNDK-IKVIHDNVDNEFNALSAKIK-NVKNIQRHLASLELQL 119
            :||....|||:..|.:|||.: |.||| :|.:...::..|..|.||:: .||.:     |||..|
  Fly    65 TANFRIFNETQGILDRIEGHQ-EVNDKQLKALKVKMEGHFMDLHAKMEIKVKKL-----SLEKSL 123

  Fly   120 QETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSED 184
            ::...||..|::.:.|..|..:..:|:|:|.|.|:||:..|.:||.|.:.|.:||.||.:.|:|:
  Fly   124 RKALNALQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEE 188

  Fly   185 ELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCVHLRGG 249
            ||..|..:|     .:..:|||::|:...|::|||.:|...|||||:|.:|..: :.:||.::||
  Fly   189 ELHLISQKL-----DTESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNRE-NAQCVRVKGG 247

  Fly   250 EMMDGKCSEQFLFICQLAVN 269
            .....:|..:.|||||...|
  Fly   248 LYQTFQCDHRVLFICQANQN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 39/106 (37%)
CG2839NP_608540.1 CLECT 147..263 CDD:214480 46/121 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448758
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.