DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and lectin-21Cb

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster


Alignment Length:272 Identity:87/272 - (31%)
Similarity:139/272 - (51%) Gaps:32/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFQHANFFLHVFMACGLYGIRAKDVCPRMSTDK------EVCLVELAPVLKYI-SNNHKSHWNSA 58
            ||::..:||::.:.....|.:..: ||::|..:      |..|||..|:||:| .|.||      
  Fly     1 MFKYDTYFLYLIVLLDPQGAQENN-CPKVSLSERLEKRGEFSLVEFDPLLKFIVKNPHK------ 58

  Fly    59 NEVQVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQLQETK 123
                     :.|.:|||....|.:|::.:...:.|:..||    .|..::...|..|:..||:..
  Fly    59 ---------ELLGEIEGLVGHTENKLQPMKSVIPNQSKAL----LNYLDLHSKLEYLDAALQKAI 110

  Fly   124 KALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDA 188
            .:|..|::..|||...:...:|||:|.|:|:||:..:.:||.|...|.:||.||.|.|.||||..
  Fly   111 NSLQCSLKNTKVMSTGKPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYL 175

  Fly   189 IRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCVHLRGGEMMD 253
            ||.:|:     :..|||||:::....::||||||....:|||....|:......|.:|..|:...
  Fly   176 IRKQLE-----ARWFWLDISNLVDKDQYISLATGKEVSYLKWRHGEPKKSSTANCAYLYAGDYYT 235

  Fly   254 GKCSEQFLFICQ 265
            .:||::..||||
  Fly   236 YQCSDRNFFICQ 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 39/106 (37%)
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 43/114 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448759
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
109.900

Return to query results.
Submit another query.