DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and CD209

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_066978.1 Gene:CD209 / 30835 HGNCID:1641 Length:404 Species:Homo sapiens


Alignment Length:222 Identity:42/222 - (18%)
Similarity:96/222 - (43%) Gaps:26/222 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 QVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKIKNV------KNIQRHLASLEL--- 117
            ::.|..::|.:::....|..:|.|  ...:..|...|.|.:..:      :.|.:.|..|:.   
Human   165 KMQEIYQELTRLKAAVGELPEKSK--QQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVG 227

  Fly   118 QLQETKKALNLSVEAKKVMPKTE-----IPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHL 177
            :|.|..|...:..|..::....|     .|.::.......:|:....: :|..:.:.|.::||.|
Human   228 ELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQR-NWHDSITACKEVGAQL 291

  Fly   178 LTIQSEDELDAIRTELKDINDGSHDF-WLDINDIAKWG--EFISLATGMNPPFLK-WHKHRPQVQ 238
            :.|:|.:|.:.::.:    :..|:.| |:.::|:.:.|  :::. .:.:.|.|.: |::..|...
Human   292 VVIKSAEEQNFLQLQ----SSRSNRFTWMGLSDLNQEGTWQWVD-GSPLLPSFKQYWNRGEPNNV 351

  Fly   239 IHQRCVHLRGGEMMDGKCSEQFLFICQ 265
            ..:.|....|....|.||:....:||:
Human   352 GEEDCAEFSGNGWNDDKCNLAKFWICK 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 23/110 (21%)
CD209NP_066978.1 Endocytosis signal 14..15
Endocytosis signal. /evidence=ECO:0000255 16..18
Endocytosis signal. /evidence=ECO:0000255 31..34
transmembrane domain 36..59
PilO 38..>184 CDD:294757 3/18 (17%)
neck domain 60..249 15/85 (18%)
CLECT_DC-SIGN_like 256..379 CDD:153060 26/129 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.