DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Clec11a

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001012477.1 Gene:Clec11a / 29313 RGDID:3627 Length:328 Species:Rattus norvegicus


Alignment Length:271 Identity:49/271 - (18%)
Similarity:90/271 - (33%) Gaps:69/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 NSANEVQVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKIKN-VKNIQRHLASLELQL 119
            |..|..:.:|.::.....|.|.:|..::......:....|.:.|...:: |..|...||||:..|
  Rat    63 NKDNLAENSEGKEVWEATETQGEEEEEETTTTPSSSPTPFPSPSPTSEDTVTYILGRLASLDAGL 127

  Fly   120 QETKKALNL------------------------SVEAKKVMPKTEIPSQFQ-----------KIG 149
            .:....|::                        ||:|.|   :.::.|:.:           ::|
  Rat   128 HQLHIRLHVLDTRVVELTQGLRRLRDAASDTRDSVQALK---EVQVRSEQEHGRLEGCLKGLRLG 189

  Fly   150 WRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDA----IRTELKDINDGSHDFWLDINDI 210
            .:.|.:.:..:.. ..|.:.|...|..|.......::||    :|..|...|   ...||.::|.
  Rat   190 HKCFLLSRDFETQ-AAAQARCKARGGSLAQPADRQQMDALSRYLRAALAPYN---WPVWLGVHDR 250

  Fly   211 AKWGEFISLATGMNPPFLKWHK-------------------HRPQVQIHQRCVHLRG--GEMMDG 254
            ...|.:: ...|....|..||:                   .:|...|.:.||....  |...|.
  Rat   251 RSEGLYL-FENGQRVSFFAWHRALSPESGAQPSAASHPLSPDQPNGGILENCVAQASDDGSWWDH 314

  Fly   255 KCSEQFLFICQ 265
            .|..:..|:|:
  Rat   315 DCERRLYFVCE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 25/131 (19%)
Clec11aNP_001012477.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..111 8/47 (17%)
CLECT 182..326 CDD:413318 28/149 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5345
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.