DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and CLEC4E

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_055173.1 Gene:CLEC4E / 26253 HGNCID:14555 Length:219 Species:Homo sapiens


Alignment Length:173 Identity:31/173 - (17%)
Similarity:58/173 - (33%) Gaps:65/173 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 KTEIPSQFQK----------------IGWRHF----FIEKKHKVDWFKATSMCHKMGAHLLTIQS 182
            |.::|..|.:                :.|.:|    :......:.|..:...|..|||||:.|.|
Human    56 KFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINS 120

  Fly   183 EDELDAI---RTELKDINDGSHD-------FWLDINDIAK----W--GEFISLAT--------GM 223
            ::|.:.:   :.::::...|..|       .|:|...:.|    |  ||..::||        ..
Human   121 QEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDS 185

  Fly   224 NPPFLKWHKHRPQVQIHQRCVHLRGGEMMDGKCSEQFLFICQL 266
            :.|...|:                     |..|...:..||::
Human   186 SNPRQNWN---------------------DVTCFLNYFRICEM 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 25/130 (19%)
CLEC4ENP_055173.1 CLECT_DC-SIGN_like 80..207 CDD:153060 28/147 (19%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000303|PubMed:24101491 169..171 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.