DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Klrb1b

DIOPT Version :10

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_775414.2 Gene:Klrb1b / 25192 RGDID:2975 Length:223 Species:Rattus norvegicus


Alignment Length:108 Identity:26/108 - (24%)
Similarity:48/108 - (44%) Gaps:12/108 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 VDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDIN---DIAKWGEFISLATG 222
            :.|..:.:.|...||.||.:|.::||..:|...|.|   |..||:.::   ...|| ::|:.:| 
  Rat   113 ITWKGSLADCGGKGATLLLVQDQEELRFLRNLTKRI---SSSFWIGLSYTLSDEKW-KWINGST- 172

  Fly   223 MNPPFLKWHKHRPQVQIHQRCVHLRGGEMMDGKCSEQFLFICQ 265
            :|...|.......:    ..|..:...:::...|....::|||
  Rat   173 LNSDALNITGDTEK----DSCASVSQDKVLSESCDSDNIWICQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 24/106 (23%)
Klrb1bNP_775414.2 ITIM motif 5..10
LCK-binding motif. /evidence=ECO:0000250|UniProtKB:P27812 31..34
CLECT_NK_receptors_like 94..212 CDD:153063 26/108 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.