DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Cd207

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_659192.2 Gene:Cd207 / 246278 MGIID:2180021 Length:331 Species:Mus musculus


Alignment Length:230 Identity:58/230 - (25%)
Similarity:97/230 - (42%) Gaps:39/230 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 EVQ---VNET----RKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLEL 117
            |||   ||.|    |.|:..:|...|..||:::::..:. .|.::|||||..:|......::|..
Mouse   109 EVQMQIVNTTLKRVRSQILSLETSMKIANDQLQILTMSW-GEVDSLSAKIPELKRDLDKASALNT 172

  Fly   118 QLQETKKAL-NLSVEAKKVMPKTEIPSQFQKIGWRHF-----FIEKKHKVDWFKATSMCHKMGAH 176
            ::|..:.:| |::...|:.....|:.::    ||::|     :..:..|. |:.|...|....||
Mouse   173 KVQGLQNSLENVNKLLKQQSDILEMVAR----GWKYFSGNFYYFSRTPKT-WYSAEQFCISRKAH 232

  Fly   177 LLTIQSEDE-------LDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKHR 234
            |.::.||.|       .|.|...:.....||...|.       |.:..|.....:..|  |....
Mouse   233 LTSVSSESEQKFLYKAADGIPHWIGLTKAGSEGDWY-------WVDQTSFNKEQSRRF--WIPGE 288

  Fly   235 P-QVQIHQRCVHLRGGEMM---DGKCSEQFLFICQ 265
            | ....::.|.::|...:.   ||.|...|||||:
Mouse   289 PNNAGNNEHCANIRVSALKCWNDGPCDNTFLFICK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 29/117 (25%)
Cd207NP_659192.2 CLECT_DC-SIGN_like 201..324 CDD:153060 33/133 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.