Sequence 1: | NP_652642.2 | Gene: | lectin-21Ca / 53552 | FlyBaseID: | FBgn0040107 | Length: | 269 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_775598.2 | Gene: | Colec10 / 239447 | MGIID: | 3606482 | Length: | 277 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 36/207 - (17%) |
---|---|---|---|
Similarity: | 79/207 - (38%) | Gaps: | 47/207 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 KQLAKIEGQEKETN-----DKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQLQETKKALN 127
Fly 128 LSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTE 192
Fly 193 LKD--INDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRP-QVQIHQRCVH-LRGGEMMD 253
Fly 254 GKCSEQFLFICQ 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-21Ca | NP_652642.2 | CLECT | 158..265 | CDD:153057 | 22/110 (20%) |
Colec10 | NP_775598.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 41..103 | 36/207 (17%) | |
Collagen | 45..93 | CDD:189968 | |||
CLECT_collectin_like | 157..272 | CDD:153061 | 24/146 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 61 | 1.000 | Domainoid score | I10387 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_100086 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |