DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Sftpd

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_033186.1 Gene:Sftpd / 20390 MGIID:109515 Length:374 Species:Mus musculus


Alignment Length:154 Identity:40/154 - (25%)
Similarity:64/154 - (41%) Gaps:18/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 ALNLSVEA-KKVMPKTEIP-SQFQK---------IGWRHFFIEKKHKVDWFKATSMCHKMGAHLL 178
            ||...:|| |..:.:.|:. |.:||         :|.:.|......| .:..|..||.:.|..|.
Mouse   225 ALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEK-PFEDAQEMCKQAGGQLA 288

  Fly   179 TIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRPQVQ-IHQR 242
            :.:|..|..||:..:...|..:   :|.:.|:...|:| :..||....:..|....|... ..:.
Mouse   289 SPRSATENAAIQQLITAHNKAA---FLSMTDVGTEGKF-TYPTGEPLVYSNWAPGEPNNNGGAEN 349

  Fly   243 CVHL-RGGEMMDGKCSEQFLFICQ 265
            ||.: ..|:..|..|.||.|.||:
Mouse   350 CVEIFTNGQWNDKACGEQRLVICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 28/108 (26%)
SftpdNP_033186.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..222
Collagen 45..102 CDD:189968
Collagen 129..>171 CDD:189968
Surfac_D-trimer 223..267 CDD:286141 11/41 (27%)
CLECT_collectin_like 261..374 CDD:153061 30/118 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 61 1.000 Domainoid score I10387
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.