DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Clec11a

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_033157.1 Gene:Clec11a / 20256 MGIID:1298219 Length:328 Species:Mus musculus


Alignment Length:268 Identity:52/268 - (19%)
Similarity:90/268 - (33%) Gaps:63/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 NSANEVQVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKIKN-VKNIQRHLASLELQL 119
            |..|..:..|.::.....|.|.:|..::|.....:..|.|.:.|...:: |..|...||||:..|
Mouse    63 NEDNLAENPEDKEVWETTETQGEEEEEEITTAPSSSPNPFPSPSPTPEDTVTYILGRLASLDAGL 127

  Fly   120 QETKKALNL------------------------SVEA-KKVMPKTEIPS-------QFQKIGWRH 152
            .:....|::                        ||:| |:|..:.|...       :..::|.:.
Mouse   128 HQLHVRLHVLDTRVVELTQGLRQLRDAASDTRDSVQALKEVQDRAEQEHGRLEGCLKGLRLGHKC 192

  Fly   153 FFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDA----IRTELKDINDGSHDFWLDINDIAKW 213
            |.:.:..:.. ..|.:.|...|..|.......::||    :|..|...|   ...||.::|....
Mouse   193 FLLSRDFETQ-AAAQARCKARGGSLAQPADRQQMDALSRYLRAALAPYN---WPVWLGVHDRRSE 253

  Fly   214 GEFISLATGMNPPFLKWHK-------HRPQVQIH------------QRCVHLRG--GEMMDGKCS 257
            |.:: ...|....|..||:       .:|....|            :.||....  |...|..|.
Mouse   254 GLYL-FENGQRVSFFAWHRAFSLESGAQPSAATHPLSPDQPNGGVLENCVAQASDDGSWWDHDCE 317

  Fly   258 EQFLFICQ 265
            .:..|:|:
Mouse   318 RRLYFVCE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 25/131 (19%)
Clec11aNP_033157.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..111 10/47 (21%)
CLECT 182..326 CDD:295302 28/149 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I5445
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.