Sequence 1: | NP_652642.2 | Gene: | lectin-21Ca / 53552 | FlyBaseID: | FBgn0040107 | Length: | 269 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502375.4 | Gene: | clec-185 / 182914 | WormBaseID: | WBGene00007729 | Length: | 504 | Species: | Caenorhabditis elegans |
Alignment Length: | 214 | Identity: | 47/214 - (21%) |
---|---|---|---|
Similarity: | 81/214 - (37%) | Gaps: | 50/214 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 KIKVIHDNVDN--EFNALSAKIKNVKNIQRHLASLELQLQETKKAL------NLSVEAKKVMPKT 139
Fly 140 EIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKM--GAHLLTIQSEDELDAIRTELKDINDGSHD 202
Fly 203 FWLDINDIAKWGEFISLATGMNPPFLKWHKHRPQ---VQIHQRCVHLRGGEMMDG---------- 254
Fly 255 --------KCSEQFLFICQ 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-21Ca | NP_652642.2 | CLECT | 158..265 | CDD:153057 | 26/129 (20%) |
clec-185 | NP_502375.4 | CLECT | 84..217 | CDD:214480 | 28/149 (19%) |
CLECT | 391..500 | CDD:214480 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |