powered by:
Protein Alignment lectin-21Ca and clec-150
DIOPT Version :9
Sequence 1: | NP_652642.2 |
Gene: | lectin-21Ca / 53552 |
FlyBaseID: | FBgn0040107 |
Length: | 269 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_497312.1 |
Gene: | clec-150 / 175261 |
WormBaseID: | WBGene00019914 |
Length: | 362 |
Species: | Caenorhabditis elegans |
Alignment Length: | 68 |
Identity: | 16/68 - (23%) |
Similarity: | 32/68 - (47%) |
Gaps: | 6/68 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 166 ATSMCHKMGA-HLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWG--EFISLATGMNPPF 227
|...|:..|. ||.::.|..:.:.:.....:.|..::.||:.:.|:...| |:|. |::..|
Worm 51 AEKACYDYGGYHLASVPSMIDNNFLYNLSSNSNVWANYFWIGLTDMTADGSWEWID---GLDLVF 112
Fly 228 LKW 230
:.|
Worm 113 MNW 115
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
lectin-21Ca | NP_652642.2 |
CLECT |
158..265 |
CDD:153057 |
16/68 (24%) |
clec-150 | NP_497312.1 |
CLECT |
33..147 |
CDD:214480 |
16/68 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR22802 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.