DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Mbl2

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001351987.1 Gene:Mbl2 / 17195 MGIID:96924 Length:244 Species:Mus musculus


Alignment Length:196 Identity:47/196 - (23%)
Similarity:81/196 - (41%) Gaps:43/196 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GQEKETNDKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQLQETKKALNLSVEAKKVMPKT 139
            |.:.:..|:.:.....:|:|..||.::::.::|..  |.||.                       
Mouse    88 GPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWV--LFSLS----------------------- 127

  Fly   140 EIPSQFQKIGWRHFFIE-KKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDF 203
                  :|:|.::|... ||..:|..||  :|.:....:.|.::.:|..||:...|||      .
Mouse   128 ------EKVGKKYFVSSVKKMSLDRVKA--LCSEFQGSVATPRNAEENSAIQKVAKDI------A 178

  Fly   204 WLDINDIAKWGEFISLATGMNPPFLKWHKHRP-QVQIHQRCVHLRG-GEMMDGKCSEQFLFICQL 266
            :|.|.|:...|.|..| ||....:..|:...| .....:.||.:.| |:..|..||:.||.||:.
Mouse   179 YLGITDVRVEGSFEDL-TGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEF 242

  Fly   267 A 267
            :
Mouse   243 S 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 32/108 (30%)
Mbl2NP_001351987.1 Collagen 36..93 CDD:189968 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..101 2/12 (17%)
CLECT 132..242 CDD:382969 35/118 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.