DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and CLEC4C

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001358319.1 Gene:CLEC4C / 170482 HGNCID:13258 Length:213 Species:Homo sapiens


Alignment Length:176 Identity:41/176 - (23%)
Similarity:65/176 - (36%) Gaps:32/176 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 KNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMC 170
            |.::| |:.|. :.|:...:|...:|.|.:...:..|:.:.......:||....: .|.|:...|
Human    50 KTVKR-LSKLR-EYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQ-SWTKSQKNC 111

  Fly   171 HKMGAHLLTIQSEDELDAIRTELK----------DINDGSHDFWLDINDIAKWGEFISLATGMNP 225
            ..|||.|:.|.:.:|.|.|...||          |.....|..|:|             .|..|.
Human   112 SVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVD-------------QTPYNE 163

  Fly   226 PFLKWHKHRPQVQIHQRC--VHLRGGE---MMDGKCSEQFLFICQL 266
            ....||...|. .:.:||  ::.|..|   ..|..|......||::
Human   164 NVTFWHSGEPN-NLDERCAIINFRSSEEWGWNDIHCHVPQKSICKM 208

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 29/121 (24%)
CLEC4CNP_001358319.1 CLECT_DC-SIGN_like 83..208 CDD:153060 33/139 (24%)
Carbohydrate binding. /evidence=ECO:0000269|PubMed:25995448, ECO:0007744|PDB:4ZET 184..186 0/1 (0%)