DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and CLEC4F

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_011530937.1 Gene:CLEC4F / 165530 HGNCID:25357 Length:699 Species:Homo sapiens


Alignment Length:198 Identity:43/198 - (21%)
Similarity:80/198 - (40%) Gaps:67/198 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 QLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKIK----NVKNIQRHL----------------- 112
            |..|..|:..:|:.:|:|....::| .|.|:|:|:    ::||..|.:                 
Human   454 QTQKANGRLDQTDTQIQVFKSEMEN-VNTLNAQIQVLNGHMKNASREIQTLKQGMKNASALTSQT 517

  Fly   113 ---------ASLELQ-----LQETK-------------KALNLSVEAKKVMPKTEIPSQFQKI-- 148
                     ||.|:|     |:.||             |.|::.:.:::.:.:|:  ||..::  
Human   518 QMLDSNLQKASAEIQRLRGDLENTKALTMEIQQEQSRLKTLHVVITSQEQLQRTQ--SQLLQMVL 580

  Fly   149 -GWR------HFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLD 206
             ||:      ::|  ...|..|.:|...|...||||.::.|::| .|...|.    .....:|:.
Human   581 QGWKFNGGSLYYF--SSVKKSWHEAEQFCVSQGAHLASVASKEE-QAFLVEF----TSKVYYWIG 638

  Fly   207 IND 209
            :.|
Human   639 LTD 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 14/52 (27%)
CLEC4FXP_011530937.1 Lebercilin 374..556 CDD:292252 21/102 (21%)
CLECT_DC-SIGN_like 581..>657 CDD:153060 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.