DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Fcer2a

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_006508760.1 Gene:Fcer2a / 14128 MGIID:95497 Length:335 Species:Mus musculus


Alignment Length:257 Identity:57/257 - (22%)
Similarity:101/257 - (39%) Gaps:56/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KYISNNHKSHWNSANEVQVNETRKQLAKIEGQEKETNDKIKVIHDN-----------------VD 92
            |:.||      ..|.:.||.:..:.|.:::.::|:...:...:..|                 :.
Mouse    79 KFQSN------QLAQKSQVVQMSQNLQELQAEQKQMKAQDSRLSQNLTGLQEDLRNAQSQNSKLS 137

  Fly    93 NEFNALSAKIKNVKNI---QRHLASLELQ-LQETKKALNLSVEAKK-----VMPKTEIPSQFQKI 148
            ...|.|...:.|:|::   ::..||..|: |||....|.:.:...|     :.||          
Mouse   138 QNLNRLQDDLVNIKSLGLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPK---------- 192

  Fly   149 GWRHF----FIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDIND 209
            .|.||    :...|....|.:|...|..:...|::|.|:.|.|.:   ::.||  ..|.|:.:.|
Mouse   193 NWLHFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFL---MQHIN--KKDSWIGLQD 252

  Fly   210 IAKWGEFISLATGMNPPFLKWHKHRPQVQIH-QRCVHLRG-GEMMDGKCSEQF-LFIC-QLA 267
            :...|||: .:.|....:..|:...|..... :.||.:|| |:..|..|.... .::| |||
Mouse   253 LNMEGEFV-WSDGSPVGYSNWNPGEPNNGGQGEDCVMMRGSGQWNDAFCRSYLDAWVCEQLA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 28/110 (25%)
Fcer2aXP_006508760.1 SH3_and_anchor <77..>175 CDD:275056 19/101 (19%)
CLECT_DC-SIGN_like 190..310 CDD:153060 32/135 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.