DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Bcan

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_030108256.1 Gene:Bcan / 12032 MGIID:1096385 Length:900 Species:Mus musculus


Alignment Length:130 Identity:31/130 - (23%)
Similarity:58/130 - (44%) Gaps:18/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 FQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDF-WLDIN 208
            ||...::||...:    .|.:|.|.|..:||||.:|.:.:|.|.       :||...:: |:.:|
Mouse   688 FQGACYKHFSTRR----SWEEAESQCRALGAHLTSICTPEEQDF-------VNDRYREYQWIGLN 741

  Fly   209 DIAKWGEFISLATGMNPPFLKWHKHRPQVQI--HQRCVHL---RGGEMMDGKCSEQFLFICQLAV 268
            |....|:|: .:.|....:..|:..:|....  .:.||.:   ..|:..|..|:....:.|::.:
Mouse   742 DRTIEGDFL-WSDGAPLLYENWNPGQPDSYFLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGL 805

  Fly   269  268
            Mouse   806  805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 26/112 (23%)
BcanXP_030108256.1 Ig 65..174 CDD:386229
Link_domain_CSPGs_modules_1_3 173..267 CDD:239594
Link_domain_CSPGs_modules_2_4 274..369 CDD:239597
Treacle 499..>635 CDD:367557
EGF 643..672 CDD:333761
CLECT 681..804 CDD:382969 31/127 (24%)
CCP 808..865 CDD:153056
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.