DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment lectin-21Ca and Acan

DIOPT Version :9

Sequence 1:	NP_652642.2	Gene:	lectin-21Ca / 53552	FlyBaseID:	FBgn0040107	Length:	269	Species:	Drosophila melanogaster
Sequence 2:	NP_001348429.1	Gene:	Acan / 11595	MGIID:	99602	Length:	2170	Species:	Mus musculus

Alignment Length:	130	Identity:	35/130 - (26%)
Similarity:	58/130 - (44%)	Gaps:	20/130 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly   143 SQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDF-WLD 206
            ::||...:|||    ..:..|..|...|.:..:||.:|.:.:|.:.       :|..:.|: |:.
Mouse  1965 TKFQGHCYRHF----HDRETWVDAERRCREQQSHLSSIVTPEEQEF-------VNKNAQDYQWIG 2018

  Fly   207 INDIAKWGEFISLATGMNPPFLKWHKHRPQ--VQIHQRCV----HLRGGEMMDGKCSEQFLFICQ 265
            :||....|:| ..:.|.:..|.||..::|.  ....:.||    |.| ||..|..|:.|..|.|:
Mouse  2019 LNDRTIEGDF-RWSDGHSLQFEKWRPNQPDNFFATGEDCVVMIWHER-GEWNDVPCNYQLPFTCK 2081

Fly 266 265
Mouse 2082 2081

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
lectin-21Ca	NP_652642.2	CLECT	158..265	CDD:153057	29/113 (26%)
Acan	NP_001348429.1	Ig_Aggrecan	43..154	CDD:143308
		G1-A	48..140
		G1-B	152..247
		Link_domain_CSPGs_modules_1_3	153..247	CDD:239594
		G1-B'	253..349
		Link_domain_CSPGs_modules_2_4	254..349	CDD:239597
		G2-B	486..580
		Link_domain_CSPGs_modules_1_3	487..581	CDD:239594
		G2-B'	587..682
		Link_domain_CSPGs_modules_2_4	588..683	CDD:239597
		KS	685..803
		Herpes_ICP4_C	689..>1027	CDD:332854
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	737..1079
		CS-1	805..1231
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1108..1239
		AidA	<1171..>1630	CDD:330218
		Cell attachment site. /evidence=ECO:0000255	1171..1173
		CS-2	1232..1917
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1299..1465
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1491..1538
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1586..1671
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1782..1838
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1861..1914
		EGF_CA	1918..1954	CDD:238011
		CLECT_CSPGs	1960..2083	CDD:153058	35/130 (27%)
		CCP	2087..2143	CDD:153056
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R4956
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.940