DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and COLEC10

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_006429.2 Gene:COLEC10 / 10584 HGNCID:2220 Length:277 Species:Homo sapiens


Alignment Length:179 Identity:33/179 - (18%)
Similarity:68/179 - (37%) Gaps:42/179 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 VDNEFNALSAKIKNVKNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFI 155
            :|.....|...:|.|||:   :|.    ::||::                          :.::|
Human   131 LDISIARLKTSMKFVKNV---IAG----IRETEE--------------------------KFYYI 162

  Fly   156 EKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKD--INDGSHDFWLDINDIAKWGEFIS 218
            .::.| ::.::.:.|...|..|...:.|    |..|.:.|  ...|....::.:||:.:.|:::.
Human   163 VQEEK-NYRESLTHCRIRGGMLAMPKDE----AANTLIADYVAKSGFFRVFIGVNDLEREGQYMF 222

  Fly   219 LATGMNPPFLKWHKHRPQVQI-HQRCVH-LRGGEMMDGKCSEQFLFICQ 265
            ........:..|::..|.... |:.||. |..|...|.:|.....|:|:
Human   223 TDNTPLQNYSNWNEGEPSDPYGHEDCVEMLSSGRWNDTECHLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 22/110 (20%)
COLEC10NP_006429.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..107
Collagen 45..111 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 24/146 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.