DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and CLEC4M

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_055072.3 Gene:CLEC4M / 10332 HGNCID:13523 Length:399 Species:Homo sapiens


Alignment Length:227 Identity:40/227 - (17%)
Similarity:97/227 - (42%) Gaps:36/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 QVNETRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKI------KNVKNIQRHLASLEL--- 117
            ::.|..::|.:::....|..:|.|:  ..:..|...|.|.:      ..::.|.:.|..|:.   
Human   177 KLQEIYQELTRLKAAVGELPEKSKL--QEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVG 239

  Fly   118 QLQETKKALNLSVEAKKVMPKTEIPSQFQKI------GWRHF-----FIEKKHKVDWFKATSMCH 171
            :|.:..|...:..|.      |::.:.|:::      .|..|     |:....: :|..:.:.|.
Human   240 ELPDQSKQQQIYQEL------TDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQR-NWHDSVTACQ 297

  Fly   172 KMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWG--EFISLATGMNPPFLK-WHKH 233
            ::.|.|:.|::.:|.:.::.:....|..|   |:.::|:.:.|  :::. .:.::|.|.: |:..
Human   298 EVRAQLVVIKTAEEQNFLQLQTSRSNRFS---WMGLSDLNQEGTWQWVD-GSPLSPSFQRYWNSG 358

  Fly   234 RPQVQIHQRCVHLRGGEMMDGKCSEQFLFICQ 265
            .|....::.|....|....|.:|.....:||:
Human   359 EPNNSGNEDCAEFSGSGWNDNRCDVDNYWICK 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 20/109 (18%)
CLEC4MNP_055072.3 Endocytosis signal. /evidence=ECO:0000250 14..15
transmembrane domain 44..71
7 X approximate tandem repeats 108..269 16/99 (16%)
DUF342 <140..251 CDD:302792 13/75 (17%)
CLECT_DC-SIGN_like 268..391 CDD:153060 24/128 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.