Sequence 1: | NP_652642.2 | Gene: | lectin-21Ca / 53552 | FlyBaseID: | FBgn0040107 | Length: | 269 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005172686.1 | Gene: | si:ch73-111e15.1 / 101885260 | ZFINID: | ZDB-GENE-110411-28 | Length: | 271 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 48/200 - (24%) |
---|---|---|---|
Similarity: | 78/200 - (39%) | Gaps: | 48/200 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 90 NVDNEFNALSAKIKNVKNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKI-GWRHF 153
Fly 154 -----FIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIA-- 211
Fly 212 ---KWGEFISLATGMNPPFLKWHKHR----PQVQIHQRCV--HL-RGGEM---MDGKCSEQFLFI 263
Fly 264 CQLAV 268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-21Ca | NP_652642.2 | CLECT | 158..265 | CDD:153057 | 30/121 (25%) |
si:ch73-111e15.1 | XP_005172686.1 | CLECT_DC-SIGN_like | 139..264 | CDD:153060 | 34/136 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X29 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.100 |