DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and zmp:0000000924

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_021327939.1 Gene:zmp:0000000924 / 101884643 ZFINID:ZDB-GENE-130530-927 Length:276 Species:Danio rerio


Alignment Length:314 Identity:62/314 - (19%)
Similarity:103/314 - (32%) Gaps:102/314 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 MACGLYGIRAKDVCPRMSTDKEVCLVELAPVLKYISNNHKSHWNSANEVQVNETRKQLAKIEGQE 77
            |:..:|....|....||:.::    ||:|.|: |.|.:.||:....|    ..|...|:     :
Zfish     1 MSEDIYNNVIKTESERMNRER----VEMAVVI-YESTDCKSNRYCTN----TNTLSFLS-----D 51

  Fly    78 KET-----------NDKIKV---------------------------IHDNVDN---EFNALSAK 101
            |||           :|.:|.                           |:.|..|   |...|...
Zfish    52 KETFTVYSCLSSPGSDSVKTRFSRAAPVCLVLLCFLLLTAVIVLSVFIYTNNTNYTEERRQLITN 116

  Fly   102 IKNVKNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQF-QKIGWRH----FFIEKKHKV 161
            |.|:...:..|.:|.....:..|.|.:                | |:.||.:    |:.......
Zfish   117 ITNLTGAKDELTNLLYDKDQLIKWLQI----------------FGQEAGWFYYQSSFYYFSNETK 165

  Fly   162 DWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIA-----KWGEFISLAT 221
            .|.::...|....|.|:.|.::.|.|.|..     ...:::||:.:.||.     ||.:...|.:
Zfish   166 SWTESRRYCRDKRADLIIINNKQEQDFIMK-----ITCNNEFWIGLTDIKKEGTWKWVDGSILTS 225

  Fly   222 GMNPPFLKWHK----HRPQVQIHQRC--VHLRGGE----MMDGKCSEQFLFICQ 265
            |.      |..    :.|.....:.|  .||:...    .:|..|.:...:||:
Zfish   226 GF------WASSGSINEPNGGKTENCAVTHLKKHPELIGWLDVTCDDAHQWICE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 24/121 (20%)
zmp:0000000924XP_021327939.1 CLECT_DC-SIGN_like 146..274 CDD:153060 29/139 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.