DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and zmp:0000000937

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_021327947.1 Gene:zmp:0000000937 / 101884588 ZFINID:ZDB-GENE-130530-940 Length:290 Species:Danio rerio


Alignment Length:272 Identity:62/272 - (22%)
Similarity:102/272 - (37%) Gaps:57/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RAKDVCPRMSTDKEVCLVELAPVLKYISNNHKSHWNSANEVQVNETRKQLAKIEGQEKETNDKIK 85
            ||..||..:     :||:.|..|:..      |.:...|.....|.|:||  |......|.|:.|
Zfish    41 RAAPVCLVL-----LCLLLLTAVIVL------SVFIYTNNTNFAEERRQL--ITNIANITEDRDK 92

  Fly    86 VIHDNVDNEFNALSAKIK-----NVKNIQRHLASLELQLQETKKALN--LSVEAKKVMPKTEIPS 143
            ::.|.::      ..|||     |:.|::.....|..::....||.|  |...|..:..|.::..
Zfish    93 LLTDIIN------LTKIKDKVLINITNLEEDRDELLNKITTFTKARNEILKKNANLLKDKDQLIK 151

  Fly   144 QFQKIGWR-----HFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDF 203
            |.|..|..     .|:.....:..|.::...|...||.|:.|.::.|.|.|   :|..:  :::|
Zfish   152 QLQVFGQEAYYQSSFYYLSSERKSWTESRRDCKDRGADLIIINNKQEQDFI---MKITS--NNEF 211

  Fly   204 WLDIND-----IAKWGEFISLATGMNPPFLKWHKH----RPQVQIHQRC--VHLRGGE----MMD 253
            |:.:.|     |.||      ..|.|.....|...    .|..:..:.|  .||:...    .:|
Zfish   212 WIGLTDSDKEGIWKW------VDGSNLTSRFWASSGSITEPNGRKTENCAVTHLKKHPELIGWLD 270

  Fly   254 GKCSEQFLFICQ 265
            ..|...:.:||:
Zfish   271 VACDGAYQWICE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 26/121 (21%)
zmp:0000000937XP_021327947.1 CLECT_DC-SIGN_like 161..283 CDD:153060 28/133 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.