DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and asgrl2

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_005170656.1 Gene:asgrl2 / 101882127 ZFINID:ZDB-GENE-080917-52 Length:299 Species:Danio rerio


Alignment Length:233 Identity:45/233 - (19%)
Similarity:87/233 - (37%) Gaps:56/233 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IKVIHDNVDNEFNALSAKIKNV------------------KNIQRHLASLELQLQETKKALNLSV 130
            :.|.|...:.:|:|...:|:|:                  ..|...::|||...:.|:.::|..:
Zfish    74 VSVNHVKFNRKFSATEVRIQNLTQIILNVISRTQELEQFGHKINADVSSLEFDQRMTETSMNNLL 138

  Fly   131 EAKKVM--PKTEIPSQFQKI------------GWRHF----FIEKKHKVDWFKATSMCHKMGAHL 177
            |:.:.:  ..:|:.....|:            .|..|    :......:.|..|...|.:..|.|
Zfish   139 ESAQALHDKVSELKCHIDKMRNNNTQELCCPDQWSLFSSNCYFFSTDGMSWDSARDECERKRAKL 203

  Fly   178 LTIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPF----LKWHKHRP-QV 237
            |.:.|:.|...:.::.|.:     .:||.:.| .:.||:..|.   ..|:    .:|...:| ..
Zfish   204 LILTSKLEKSFVVSKTKPL-----FYWLGLTD-GRTGEWEWLD---ETPYEMVRSEWRPGQPDNW 259

  Fly   238 QIH-----QRCVHL-RGGEMMDGKCSEQFLFICQLAVN 269
            :.|     :.|.|. ..|...|..||..:.:||:.|.:
Zfish   260 KAHGLGGGEDCAHFHHDGRYNDDHCSRHYRYICKAAAS 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 26/117 (22%)
asgrl2XP_005170656.1 zf-C4H2 <108..>165 CDD:313386 9/56 (16%)
CLECT_DC-SIGN_like 168..293 CDD:153060 28/133 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.