Sequence 1: | NP_652642.2 | Gene: | lectin-21Ca / 53552 | FlyBaseID: | FBgn0040107 | Length: | 269 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005743.5 | Gene: | CLEC3A / 10143 | HGNCID: | 2052 | Length: | 197 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 45/198 - (22%) |
---|---|---|---|
Similarity: | 83/198 - (41%) | Gaps: | 28/198 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 84 IKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQ----------LQETKKALNLSVEAKKVMPK 138
Fly 139 TEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDF 203
Fly 204 WLDINDIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCV---HLRGGEMMDGKCSEQFLFICQ 265
Fly 266 LAV 268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
lectin-21Ca | NP_652642.2 | CLECT | 158..265 | CDD:153057 | 29/109 (27%) |
CLEC3A | NP_005743.5 | CLECT_tetranectin_like | 68..193 | CDD:153066 | 37/139 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 49 | 1.000 | Domainoid score | I11773 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R4956 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |