DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and CLEC3A

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_005743.5 Gene:CLEC3A / 10143 HGNCID:2052 Length:197 Species:Homo sapiens


Alignment Length:198 Identity:45/198 - (22%)
Similarity:83/198 - (41%) Gaps:28/198 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQ----------LQETKKALNLSVEAKKVMPK 138
            |.::.|...:..:.|.|:..:.:.::.....|:.|          |:|.:....:.:...||..|
Human    13 ITLLLDQTTSHTSRLKARKHSKRRVRDKDGDLKTQIEKLWTEVNALKEIQALQTVCLRGTKVHKK 77

  Fly   139 TEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDF 203
            ..:.|:    |.:||          .:|...|...|..|:..::.||::|::...|....|.:||
Human    78 CYLASE----GLKHF----------HEANEDCISKGGILVIPRNSDEINALQDYGKRSLPGVNDF 128

  Fly   204 WLDINDIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCV---HLRGGEMMDGKCSEQFLFICQ 265
            ||.|||:...|:|:.: .|:...||.|.:.:|.....:.||   ....|:..|..|.....:||:
Human   129 WLGINDMVTEGKFVDV-NGIAISFLNWDRAQPNGGKRENCVLFSQSAQGKWSDEACRSSKRYICE 192

  Fly   266 LAV 268
            ..:
Human   193 FTI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 29/109 (27%)
CLEC3ANP_005743.5 CLECT_tetranectin_like 68..193 CDD:153066 37/139 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.