DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and Clec3b

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_003750657.1 Gene:Clec3b / 100912012 RGDID:1311031 Length:202 Species:Rattus norvegicus


Alignment Length:188 Identity:47/188 - (25%)
Similarity:77/188 - (40%) Gaps:37/188 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 ASLELQLQETKKALNLSVEAKK--VMPK--TEIPSQFQKIGWRHFFIEKKH----------KVD- 162
            |:.|....:||||    ..|||  |.||  .|:.::...:......:::|.          ||: 
  Rat    19 ATTESPTPKTKKA----ATAKKDLVSPKMFEELKNRLDVLAQEVALLKEKQALQTVCLKGTKVNL 79

  Fly   163 -----------WFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWGEF 216
                       :.:|:..|...|..|.|.|||.|.:|:....:.......:.||.:||:|..|.:
  Rat    80 KCLLAFTQPKTFHEASEDCISQGGTLGTPQSELENEALFEYARQSVGSEAELWLGLNDMASEGAW 144

  Fly   217 ISLATGMNPPFLKWHKH---RPQVQIHQRCVHLRG---GEMMDGKCSEQFLFICQLAV 268
            :.: ||....:..|...   :|.....:.|..|.|   |:..|.:|.:|..:|||.|:
  Rat   145 VDM-TGGRLAYKNWETEITTQPDGGKAENCAALSGAANGKWFDKRCRDQLPYICQFAI 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 31/134 (23%)
Clec3bXP_003750657.1 CLECT_tetranectin_like 71..199 CDD:153066 31/128 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5345
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.