DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and clec3bb

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_003200569.1 Gene:clec3bb / 100537161 ZFINID:ZDB-GENE-111027-16 Length:200 Species:Danio rerio


Alignment Length:207 Identity:44/207 - (21%)
Similarity:81/207 - (39%) Gaps:30/207 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 TRKQLAKIEGQEKETNDKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASL--ELQLQETKKAL-N 127
            |...|.:....:|:|.||       .|:|....:|    ::::|:.::.:  ||.|.:.::|| .
Zfish    19 THSSLQQQNTSKKKTPDK-------KDSESRVSAA----LEDLQQQISDIVEELNLLKEQQALQT 72

  Fly   128 LSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTE 192
            :.::..|:..|.              |:....|..:..|...|...|..|.|..|..:...:...
Zfish    73 VCLKGTKIHGKC--------------FLADSMKKRYHTANEDCIAKGGILATPLSSAQNTQLYEY 123

  Fly   193 LKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCVHL-RGGEMMDGKC 256
            ::.......:.||.:||:...|.:.. .||....:..|...:|.....|.|..| .||:.:|..|
Zfish   124 MRQSISADAEIWLGVNDMQTEGLWTD-QTGSAIRYKNWKLPQPDGGSAQNCAVLTSGGKWLDESC 187

  Fly   257 SEQFLFICQLAV 268
            .|:...||:..:
Zfish   188 REERASICEFNI 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 25/107 (23%)
clec3bbXP_003200569.1 CLECT 74..197 CDD:295302 29/137 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.