DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and colec11

DIOPT Version :10

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_004914539.1 Gene:colec11 / 100493760 XenbaseID:XB-GENE-952506 Length:277 Species:Xenopus tropicalis


Alignment Length:164 Identity:34/164 - (20%)
Similarity:61/164 - (37%) Gaps:16/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 IQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRH----FFIEKKHKVDWFKATS 168
            :::.:..:::|:.:      |:.|.|.|  |..:||.....|.|.    .::..|.:..:..|..
 Frog   118 LRKAVGEMDIQVAQ------LATEVKFV--KNALPSPAVVAGVRETDTKIYLLVKEEKKYIDAQD 174

  Fly   169 MCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKH 233
            .|...|..|...:.|.....|.:.:...  |....::.|||:.:.|.|:.........|.||.:.
 Frog   175 YCQGRGGTLSMPKDETTNSLIASYINQA--GLSRVFIGINDLEREGHFVYSDRSPMQTFNKWRQG 237

  Fly   234 RP-QVQIHQRCVHL-RGGEMMDGKCSEQFLFICQ 265
            .| .....:.|..: ..|...|..|.....|||:
 Frog   238 EPNNAYDEEDCAEMVSSGGWNDVSCLITMYFICE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 23/108 (21%)
colec11XP_004914539.1 Collagen <40..80 CDD:460189
CLECT_collectin_like 158..272 CDD:153061 24/116 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.