DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and clec3a

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_002935100.1 Gene:clec3a / 100486528 XenbaseID:XB-GENE-986191 Length:193 Species:Xenopus tropicalis


Alignment Length:215 Identity:49/215 - (22%)
Similarity:85/215 - (39%) Gaps:44/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VQVNETRKQLAKIEGQE----KETNDKIKVIHDNVDNEFNALSAKIKNVKNIQRHLASLELQLQE 121
            |.::.|..|.||::.::    ||.:..:|...|.:..|.|:|.                |:|..:
 Frog    15 VLLDLTCTQPAKLKTRKDRRAKEKDGDLKTQIDKLWREVNSLK----------------EMQALQ 63

  Fly   122 TKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDEL 186
            |     :.:...|:..|..:.           |.|.||   :.:|...|...|..|...:..:|.
 Frog    64 T-----VCLRGTKIHKKCYLS-----------FEETKH---FHEANEDCIAKGGTLAIPRDAEEN 109

  Fly   187 DAIRTELKDINDGSHDFWLDINDIAKWGEFISLATGMNPPFLKWHKHRPQVQIHQRCVHLR---G 248
            :|:|...|....||.:|||.|||:...|:|:.: .|:...:..|.: .|.....:.|..|.   .
 Frog   110 NALRDYGKKSLRGSGEFWLGINDMVNEGKFVDV-NGVAITYFNWER-PPNGGKRKNCALLNQASQ 172

  Fly   249 GEMMDGKCSEQFLFICQLAV 268
            |:.:|..|.....:||:..:
 Frog   173 GKWVDEVCRSLKKYICEFII 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 29/109 (27%)
clec3aXP_002935100.1 CLECT_tetranectin_like 66..190 CDD:153066 34/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm49419
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4956
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.