DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and LOC100363064

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_038945816.1 Gene:LOC100363064 / 100363064 RGDID:2324825 Length:285 Species:Rattus norvegicus


Alignment Length:282 Identity:56/282 - (19%)
Similarity:96/282 - (34%) Gaps:82/282 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 HKSHWNSANEVQVNETRKQLAKIEGQEKETNDKIKVIHDN--VDNEFNALSAKIKNVKNIQRHLA 113
            :||......|....|.:|...|.|..:...:::...:.|.  .:|:...|   |.:.|::|.||.
  Rat     4 YKSQVRGKEETGSPEKQKMAGKPELHQLNNHEEEVTLEDQGFAENDPEGL---ICSSKSLQGHLT 65

  Fly   114 ----------SLEL--------------------QLQETKKALNLSVEAKKVMPKTEIPS----- 143
                      ||.|                    |.|:.|.:.:|   .|..:|:.:..:     
  Rat    66 RAPWLLLLLISLGLFLLMLAILVQVSRICANPQGQTQDQKGSSSL---GKVAVPQEQTHTGLEQI 127

  Fly   144 -QFQKI--------------------GWRHF----FIEKKHKVDWFKATSMCHKMGAHLLTIQSE 183
             |.|:|                    .|..|    ::..:....|..:.|.|..:||||:.|.|.
  Rat   128 QQIQQIQQQLTQFNASLAGLCRPCPWDWEFFQGSCYLFSRTLASWGASASSCKDLGAHLVIINSV 192

  Fly   184 DELDAIRTELKDINDGSHDFWLDINDIAK-----WGEFISLATGMNPPFLKWHKHRPQVQIHQRC 243
            .|...::......|..|   |:.::|..:     |.:...|      .|..|.:..|.....:.|
  Rat   193 AEQRFMKYWNVRKNQRS---WIGLSDHLREGSWQWVDHSPL------KFSFWKEGEPNNDGDEDC 248

  Fly   244 VHLRGGEMMDGKCSEQFLFICQ 265
            |.|...|..|..|::|..::|:
  Rat   249 VELFMDEWNDNTCTQQNFWVCE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 26/111 (23%)
LOC100363064XP_038945816.1 CLECT_DC-SIGN_like 151..270 CDD:153060 28/127 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.