DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and si:ch211-232p21.6

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_021327532.1 Gene:si:ch211-232p21.6 / 100334411 ZFINID:ZDB-GENE-131121-178 Length:149 Species:Danio rerio


Alignment Length:176 Identity:38/176 - (21%)
Similarity:68/176 - (38%) Gaps:43/176 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KIKNVKN--IQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDW 163
            ||.::||  :..|.:.|:.:|.:.|..|                           ::.....:||
Zfish     2 KINSMKNHSLPNHCSGLQEKLVQNKGRL---------------------------YVFSTDVMDW 39

  Fly   164 FKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDF-WLDIND-----IAKWGEFISL--A 220
            ..:...|..:|..|:.|.|.:|.:.:.   |.:| |.||| |:.::|     :..|.:..:|  .
Zfish    40 SSSRRRCQDLGGDLVVIDSTEEQEFLS---KKVN-GVHDFHWIGLSDSQMEGVWLWVDNTTLNND 100

  Fly   221 TGMNPPFLKWHKHRPQVQIHQRCVHLRGGEMMDGKCSEQFLFICQL 266
            |..:.|...|....|  ...:.||.|:..:..|..|..:...||::
Zfish   101 TSWDSPPDDWKAENP--LDGEDCVILKDRKWGDVSCLRKEKRICEI 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 28/114 (25%)
si:ch211-232p21.6XP_021327532.1 CLECT_DC-SIGN_like 26..143 CDD:153060 30/149 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.