DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and dcsignlg

DIOPT Version :9

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:XP_002660626.3 Gene:dcsignlg / 100320246 ZFINID:ZDB-GENE-090313-154 Length:263 Species:Danio rerio


Alignment Length:228 Identity:50/228 - (21%)
Similarity:92/228 - (40%) Gaps:49/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 VQVNETRKQLAKIEGQEKETNDKIKVI-HDNVD---------NEFNALSAKIKNVKNIQRHLASL 115
            :.:...|......:...:|.|..|..: |||.|         :::|:||.|.:.::.....|:..
Zfish    61 ISITAERDLFKTYKNTVEELNHTISSLQHDNTDLETDKQQLEDKYNSLSLKKQQLETKYNSLSLG 125

  Fly   116 ELQLQETKKALNLSVEAKKVMPKTEIPSQFQKIGWRHFFIEKKHKVDWFKATSMCHKMGAHLLTI 180
            :.||:  .:..:||.|.|:...|:         ||  ||:..: .:.|.::...|...||.|:.|
Zfish   126 KQQLE--NRVTSLSAELKEARSKS---------GW--FFMSTE-AMSWSESRQFCRDRGADLVII 176

  Fly   181 QSEDELDAIRTELKDINDGSHDFWLDIN------DIAKWGEFISLATGMNPPFLKWHKHRPQ--V 237
            :||::...|.:.:|:      |.|:.::      :..||.:...|..|.      |.|..|.  .
Zfish   177 KSEEKQRFISSLVKE------DTWIGLSVTETGGNKWKWVDNSPLNQGF------WAKGEPNNYQ 229

  Fly   238 QIHQRCVHLR-----GGEMMDGKCSEQFLFICQ 265
            ...:.||.:|     .....|.:||:....:|:
Zfish   230 GAKEDCVEVRISQGTPNNWNDRRCSDSRKAVCE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 25/119 (21%)
dcsignlgXP_002660626.3 IncA <40..>144 CDD:282066 19/84 (23%)
Uso1_p115_C 78..>146 CDD:282695 18/69 (26%)
CLECT_DC-SIGN_like 144..263 CDD:153060 31/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.