DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-21Ca and si:dkey-83f18.11

DIOPT Version :10

Sequence 1:NP_652642.2 Gene:lectin-21Ca / 53552 FlyBaseID:FBgn0040107 Length:269 Species:Drosophila melanogaster
Sequence 2:NP_001093553.1 Gene:si:dkey-83f18.11 / 100003110 ZFINID:ZDB-GENE-070705-496 Length:362 Species:Danio rerio


Alignment Length:113 Identity:28/113 - (24%)
Similarity:51/113 - (45%) Gaps:14/113 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 HFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAIRTELKDINDGSHDFWLDINDIAKWGEF 216
            ||..|.|   .|.:|...|.:....|.|:.:.:::..:...:| :||  ...|:.:....:|   
Zfish    26 HFINEMK---TWTEAQRYCREKYTDLATVDNMNDMIQLMKSVK-VND--RGVWIGLQRKWQW--- 81

  Fly   217 ISLATGMNPPFLKWHKHRPQVQIHQRCVHLRGGEMMDGKCSEQFLFIC 264
               ::|....||.|...:|...  ..|..:|.|:..||||::.::|:|
Zfish    82 ---SSGDPALFLHWGNEQPDGA--DECAFMRNGQWEDGKCNDSWIFVC 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-21CaNP_652642.2 CLECT 158..265 CDD:153057 25/107 (23%)
si:dkey-83f18.11NP_001093553.1 CLECT_1 23..126 CDD:153072 28/113 (25%)
CLECT 129..241 CDD:470576
CLECT 247..359 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.