DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CD72

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_006716956.1 Gene:CD72 / 971 HGNCID:1696 Length:366 Species:Homo sapiens


Alignment Length:358 Identity:64/358 - (17%)
Similarity:106/358 - (29%) Gaps:134/358 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CIVYLLVACNLVESRAESTENSRSVCLLKDPPNQCGEFCLSVLQPLLDHIVKHQEQWNTSEALWL 71
            |:.|||:...|             .|||..    ....||.|     .::...|:...|:..|.:
Human    92 CLRYLLLGLLL-------------TCLLLG----VTAICLGV-----RYLQVSQQLQQTNRVLEV 134

  Fly    72 NETQGKLDRIQTQLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESLKKMPAELDARLMKME 136
            ..:.     ::.||..:...|.:||:.:.|..::.....|.||.                     
Human   135 TNSS-----LRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQV--------------------- 173

  Fly   137 NQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIPEDFERKL 201
              ::......|.|:...:..:|...|.|             |.||||:          ...|:||
Human   174 --EQRAHQAAEGQLQACQADRQKTKETL-------------QSEEQQR----------RALEQKL 213

  Fly   202 QKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDM 266
            ..:|...|...|...|......          .|...::   ..|||: ..:.:||.:...|..:
Human   214 SNMENRLKPFFTCGSADTCCPS----------GWIMHQK---SCFYIS-LTSKNWQESQKQCETL 264

  Fly   267 GGYIAAIKD----QEELDAISARLDD----KSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEP 323
            ...:|...:    ......:::.|.:    .|||.|:    |||.             :|     
Human   265 SSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGL----SSNK-------------DW----- 307

  Fly   324 NHGNEDENCVELIRSKMNDDPCHRKKHVICQTD 356
                           |:.|| ..|.:| .||.:
Human   308 ---------------KLTDD-TQRTRH-SCQQE 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 17/111 (15%)
NAT_SF <170..>229 CDD:302625 12/58 (21%)
CLECT 247..354 CDD:153057 20/114 (18%)
CD72XP_006716956.1 DMPK_coil 168..223 CDD:117396 18/100 (18%)
CLECT 233..>319 CDD:214480 22/138 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.