DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Sfp24F

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001162870.1 Gene:Sfp24F / 8674016 FlyBaseID:FBgn0259958 Length:175 Species:Drosophila melanogaster


Alignment Length:128 Identity:37/128 - (28%)
Similarity:61/128 - (47%) Gaps:11/128 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 FERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKS----YWLGINDL 298
            |.|||:..:.|..|...:|..|.:.||.....:.:::..:||..:|..|...:    ||....||
  Fly    38 FVRIGNSYYLIERKLQKNWFGAYEICRQQQAELISLETFDELRLVSEYLLANNIFERYWTSGTDL 102

  Fly   299 QSSNTYVSVASGREVEFLNWNAGEPNHGNEDENCVEL------IRSK-MNDDPCHRKKHVICQ 354
            .:...:|..::|:.:....|..||||:.|.:|:|.||      .:|. |||..|:.:...||:
  Fly   103 GTKGKHVWFSNGQPLSTDLWYGGEPNNKNNEEHCDELGSDFRPTKSPGMNDRNCNFESSFICE 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 32/117 (27%)
Sfp24FNP_001162870.1 CLECT 45..165 CDD:153057 32/119 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
44.020

Return to query results.
Submit another query.