DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and colec10

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001276917.2 Gene:colec10 / 794040 ZFINID:ZDB-GENE-131127-525 Length:271 Species:Danio rerio


Alignment Length:126 Identity:27/126 - (21%)
Similarity:56/126 - (44%) Gaps:30/126 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 LFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLG--INDLQSSNTYVSV 307
            :||:...:|..:|.::..|:..||.:|           .:|.::|:..|.  |.:...::.::.:
Zfish   147 MFYLLVTEARTYQQSLLNCKLRGGTLA-----------MSRTEEKNNLLANFIREADLNHVFIRL 200

  Fly   308 ASG-REVEFLNWNAGEP------------NHGNEDENCVELIRS-KMNDDPCHRKKHVICQ 354
            .:| .||.::..| |.|            :.|..|  ||:|.|: .::...|...::.||:
Zfish   201 QAGVTEVGYMYLN-GNPLLNTTAWAIQGADSGKGD--CVQLGRTGALSQVDCGATQYYICE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 25/122 (20%)
colec10NP_001276917.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.