DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec4g

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_083741.1 Gene:Clec4g / 75863 MGIID:1923113 Length:294 Species:Mus musculus


Alignment Length:248 Identity:56/248 - (22%)
Similarity:109/248 - (43%) Gaps:22/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 LKKMPAELDARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPI----------NFEMR 175
            |..:.:...::|..:.:.|..|......| .:|..|.:|.:.|.:|...:          .|:..
Mouse    49 LSTLLSSASSKLRVLLSHQDLLRTNASEQ-KMTLSSLKDDIGACRNCCSVTKAQLQTTLAEFKDI 112

  Fly   176 LAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFER 240
            .|::.||:.:|:|..:::.:|. .|..:..:|.:.||.:  |.::..:...........|..|: 
Mouse   113 QAKLMEQESILKELQERVTQDL-AKASRDRENIRSELFQ--ALEAVKRQNSSCEQCPPSWLPFQ- 173

  Fly   241 IGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYV 305
             || .:|.:...| .|.:|..:|...|.::..::...|...:|.....:.||||:..::..|...
Mouse   174 -GS-CYYFSETQA-TWDTAQSYCGGQGAHLVIVRGLNEQGFLSQHTRGRGYWLGLRAVRHLNKIQ 235

  Fly   306 SV--ASGREVEFLNWNAGEPNHGNEDENCVELIRSKM-NDDPC-HRKKHVICQ 354
            ..  ..|..:.|.:||:||||.....|:|:.::.|.: ||.|| :.:...||:
Mouse   236 GYRWVDGASLNFSHWNSGEPNDSRGHEDCIMMLHSGLWNDAPCTNERDGWICE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 6/34 (18%)
NAT_SF <170..>229 CDD:302625 12/68 (18%)
CLECT 247..354 CDD:153057 29/110 (26%)
Clec4gNP_083741.1 COG6 61..>163 CDD:303003 20/105 (19%)
CLECT 165..289 CDD:295302 34/128 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.