DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and lectin-22C

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:360 Identity:105/360 - (29%)
Similarity:157/360 - (43%) Gaps:103/360 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRLEKCIVYLLVACNLVESRAESTENSRSVCLLKDPPNQCGEFCLSVLQPLLDHIVKHQEQWNT 65
            |.:....::..|:|.||..:.|||.    .:|.|||||:|||.|||.||.|:|:|:...|...|:
  Fly     1 MLKSASALLCGLLALNLYGAWAESD----VICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANS 61

  Fly    66 SEALWLNETQGKLDRIQTQLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESLKKMPAELDA 130
            :                                                                
  Fly    62 N---------------------------------------------------------------- 62

  Fly   131 RLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRL-AQIEEQQKLLQETLKKIP 194
                  |..|.      |::.:.:.:.:.||.||:|.. ::.|:.| ||                
  Fly    63 ------NSSKA------NEVLVRQYTMEGQLTALQNKQ-LSIEVALDAQ---------------- 98

  Fly   195 EDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSA 259
               .|||...|||..:.|..:....||.:.|:.|:.||:.:..||:|||:.:||......:|.:|
  Fly    99 ---GRKLNVNEQNFTERLNCMEGILSALEKTVLEVKTKIKYLGFEQIGSKYYYIEKVSEKNWSTA 160

  Fly   260 VDFCRDMGGYIAAIKDQEELDAISARL-DDKSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEP 323
            ...||:|||::|.|||:.:|.||.|.| :|..||||||||.....::|:.:|::..||.|.:|.|
  Fly   161 SKTCRNMGGHLADIKDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRP 225

  Fly   324 NHGNEDENCVELIRSKMNDDPCHRKKHVICQTDKE 358
            :. .:..|||.|...:|.|.|||.....||||::|
  Fly   226 SQ-LDTLNCVFLYNGEMYDYPCHYTFRFICQTEEE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 13/111 (12%)
NAT_SF <170..>229 CDD:302625 14/59 (24%)
CLECT 247..354 CDD:153057 44/107 (41%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 44/109 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4072
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.