DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec4a3

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001191170.1 Gene:Clec4a3 / 73149 MGIID:1920399 Length:237 Species:Mus musculus


Alignment Length:178 Identity:40/178 - (22%)
Similarity:75/178 - (42%) Gaps:53/178 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 AQQSANQVTLKEI-YTKV------------FW---PK-FERIGSRLFYINHKDAYDWQSAVDFCR 264
            :|....::.:||: ||::            .|   || ::..||..::.:......|..:.:.|.
Mouse    73 SQLLEEKMII
KELNYTELECTKWASLLEDKVWSCCPKDWKPFGSYCYFTSTDLVASWNESKENCF 137

  Fly   265 DMGGYIAAIKDQEELDAISARLD-DKSYWLGIND-------------LQSSNTYVSVASGREVEF 315
            .||.::..|..|||.|.|:..|| ..:|::|:::             ...:.|:           
Mouse   138 HMGAHLVVIHSQEEQDFITGILDTGTAYFIGLSNPGDQQWQWIDQTPYDDNTTF----------- 191

  Fly   316 LNWNAGEPNHGNEDENCVELIRSKM------NDDPCHRKKHVICQTDK 357
              |:.|||:  :::|.|| :|..:.      :|.||..|::.||...|
Mouse   192 --WHKGEPS--SDNEQCV-IINHRQSTGWGWSDIPCSDKQNSICHVKK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 2/11 (18%)
CLECT 247..354 CDD:153057 28/126 (22%)
Clec4a3NP_001191170.1 DUF2418 41..>82 CDD:287321 1/8 (13%)
CLECT_DC-SIGN_like 107..230 CDD:153060 31/138 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.