DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Colec11

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001300907.1 Gene:Colec11 / 71693 MGIID:1918943 Length:278 Species:Mus musculus


Alignment Length:225 Identity:49/225 - (21%)
Similarity:86/225 - (38%) Gaps:73/225 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 QKTLGDQLENQI-NLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIPEDFERKLQ 202
            :|.:| :::||: .||.|     |:.:|||:|                                 
Mouse   120 RKAIG-EMDNQVTQLTTE-----LKFIKNALP--------------------------------- 145

  Fly   203 KLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMG 267
                            ..|....::|..:|:             |:..|:...:..|...|:..|
Mouse   146 ----------------SPAAVAGVRETESKI-------------YLLVKEEKRYADAQLSCQARG 181

  Fly   268 GYIAAIKDQEELDAISARLDDKS---YWLGINDLQSSNTYVSVASGREVEFLNWNAGEPNHGNED 329
            |.::..||:.....:::.|....   .::|||||:....:|.........|..|.:||||:..::
Mouse   182 GTLSMPKDEAANGLMASYLAQAGLARVFIGINDLEKEGAFVYSDRSPMQTFNKWRSGEPNNAYDE 246

  Fly   330 ENCVELIRS-KMNDDPCHRKKHVICQTDKE 358
            |:|||::.| ..||..||...:.:|:.|||
Mouse   247 EDCVEMVASGGWNDVACHITMYFMCEFDKE 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 6/17 (35%)
NAT_SF <170..>229 CDD:302625 1/58 (2%)
CLECT 247..354 CDD:153057 30/110 (27%)
Colec11NP_001300907.1 Collagen 41..96 CDD:189968
CLECT_collectin_like 158..273 CDD:153061 32/127 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.