DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec10a

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_008766090.1 Gene:Clec10a / 64195 RGDID:621158 Length:307 Species:Rattus norvegicus


Alignment Length:266 Identity:58/266 - (21%)
Similarity:110/266 - (41%) Gaps:31/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 VPGDIKDRLDR-MEHLQTTLQESLKKMPAELDARLMKMENQQKTLGDQLENQINLTKESQQDQLE 162
            |.|....:|.| :|.|:|||..:.....|||.|...:        ||.|:..||..|....|..:
  Rat    56 VIGSQNSQLRRDLETLRTTLDNTTSNTKAELQALASR--------GDSLQTGINSLKVEVDDHGQ 112

  Fly   163 ALKNAMPINFEMRLAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGA-QQSANQVTL 226
            .|:....::  .::|.:|...:..::||:....:...::|:|.::.|....:|.: :.:.:.|..
  Rat   113 ELQAGRGLS--QKVASLESTVEKKEQTLRTDLSEITDRVQQLGKDLKTLTCQLASLKNNGSAVAC 175

  Fly   227 KEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSY 291
            ..::    |.:.|  ||..::  .:....|..|..:|:.....:.|:....|.:.:...:.....
  Rat   176 CPLH----WMEHE--GSCYWF--SQSGKPWPEADKYCQLENSNLVAVNSLAEQNFLQTHMGSVVT 232

  Fly   292 WLGINDLQSSNTYVSVASGREVE--FLNWNAGEPN----HG-NEDENCVELIR-SKMNDDPCHRK 348
            |:|:.|......:|   .|.:.|  |.:|...:|:    || ...|:|..... .:.|||.|.|.
  Rat   233 WIGLTDQNGPWRWV---DGTDYEKGFTHWAPKQPDNWYGHGLGGGEDCAHFTSDGRWNDDVCQRP 294

  Fly   349 KHVICQ 354
            ...:|:
  Rat   295 YRWVCE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 19/57 (33%)
NAT_SF <170..>229 CDD:302625 9/59 (15%)
CLECT 247..354 CDD:153057 23/114 (20%)
Clec10aXP_008766090.1 Lectin_N 21..166 CDD:281887 29/119 (24%)
Apolipoprotein <63..166 CDD:279749 27/112 (24%)
CLECT_DC-SIGN_like 176..301 CDD:153060 28/136 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.