DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and CLEC11A

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_002966.1 Gene:CLEC11A / 6320 HGNCID:10576 Length:323 Species:Homo sapiens


Alignment Length:377 Identity:74/377 - (19%)
Similarity:132/377 - (35%) Gaps:136/377 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AESTENSRSVCLLKDPPNQCGEFCLSVLQPLLD-----------HIVKHQEQWNTSEALWLNETQ 75
            |:..|..|...:||.            ||..|.           ..|:.:|.|.      :.|.|
Human    36 AQEEEREREALMLKH------------LQEALGLPAGRGDENPAGTVEGKEDWE------MEEDQ 82

  Fly    76 GKLDRIQTQLAAQALSLEESAQKVPGDIKDR-LDRMEHLQTTLQESLKKMPAELDARLMKMENQQ 139
            |:.:.   :.|....|...|....|.||... |.|:..|...|.:...::.| ||.|::::....
Human    83 GEEEE---EEATPTPSSGPSPSPTPEDIVTYILGRLAGLDAGLHQLHVRLHA-LDTRVVELTQGL 143

  Fly   140 KTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIPEDFERKLQKL 204
            :    ||.|....|:    |.::||:.|.        .:.|.:...|:..||.:           
Human   144 R----QLRNAAGDTR----DAVQALQEAQ--------GRAEREHGRLEGCLKGL----------- 181

  Fly   205 EQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDF-CRDMGG 268
                                               |:|.:.|.::..  ::.|:|... |...||
Human   182 -----------------------------------RLGHKCFLLSRD--FEAQAAAQARCTARGG 209

  Fly   269 YIAAIKDQEELDAIS----ARLDDKSY--WLGINDLQSSNTYVSVASGREVEFLNWNAG------ 321
            .:|...|:::::|::    |.|...::  |||::|.::...|: ..:|:.|.|..|:..      
Human   210 SLAQPADRQQMEALTRYLRAALAPYNWPVWLGVHDRRAEGLYL-FENGQRVSFFAWHRSPRPELG 273

  Fly   322 -------------EPNHGNEDENCVELIRSKMNDD------PCHRKKHVICQ 354
                         :|| |...||||    ::.:||      .|.|:.:.:|:
Human   274 AQPSASPHPLSPDQPN-GGTLENCV----AQASDDGSWWDHDCQRRLYYVCE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 27/123 (22%)
NAT_SF <170..>229 CDD:302625 4/58 (7%)
CLECT 247..354 CDD:153057 30/138 (22%)
CLEC11ANP_002966.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..106 11/59 (19%)
Cell attachment site. /evidence=ECO:0000255 61..63 0/1 (0%)
CLECT_tetranectin_like 177..321 CDD:153066 36/198 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..295 3/23 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.