DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and REG1A

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_002900.2 Gene:REG1A / 5967 HGNCID:9951 Length:166 Species:Homo sapiens


Alignment Length:123 Identity:36/123 - (29%)
Similarity:57/123 - (46%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 SRLFYINHKDAYDWQSAVDFCRDM-GGYIAAIKDQEELDAISARL------DDKSYWLGINDLQS 300
            |..:|.| :|...|..|..:|::| .|.:.::..|.| .|..|.|      ||.:.|:|::|.:.
Human    45 SYCYYFN-EDRETWVDADLYCQNMNSGNLVSVLTQAE-GAFVASLIKESGTDDFNVWIGLHDPKK 107

  Fly   301 SNTYVSVASGREVEFLNWNAGEPNHGNEDENCVELIRS----KMNDDPCHRKKHVICQ 354
            :..: ..:||..|.:.:|..|.|:..|.. .||.|..|    |..|.||..|...:|:
Human   108 NRRW-HWSSGSLVSYKSWGIGAPSSVNPG-YCVSLTSSTGFQKWKDVPCEDKFSFVCK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 34/117 (29%)
REG1ANP_002900.2 CLECT 36..164 CDD:470576 36/123 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.