DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and Clec1b

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_064369.1 Gene:Clec1b / 56760 MGIID:1913287 Length:229 Species:Mus musculus


Alignment Length:190 Identity:44/190 - (23%)
Similarity:75/190 - (39%) Gaps:35/190 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 LAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTK-VFWPKFE 239
            :..:.:|:.||.|     .|:....||:|.:....||.:    ||       ||.|| .|..|..
Mouse    52 IMSVTQQKYLLAE-----KENLSATLQQLAKKFCQELIR----QS-------EIKTKSTFEHKCS 100

  Fly   240 RIGSRLFYINHKDA--------YDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGIN 296
            ...::..|  |.|:        ..|:.:..:|.:....:.....|..||.|:.|:.... |:|::
Mouse   101 PCATKWRY--HGDSCYGFFRRNLTWEESKQYCTEQNATLVKTASQSTLDYIAERITSVR-WIGLS 162

  Fly   297 DLQSSNTYVSVASGREVEFLNWNAGEPNHGNEDE--NCVELIRSKMNDDPCHRKKHVICQ 354
            ...|...::    ..:...|..| |....||.:|  ||..|...|::...|..:.::||:
Mouse   163 RQNSKKDWM----WEDSSVLRKN-GINLSGNTEENMNCAYLHNGKIHPASCKERHYLICE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 12/52 (23%)
CLECT 247..354 CDD:153057 25/116 (22%)
Clec1bNP_064369.1 CLECT_NK_receptors_like 102..218 CDD:153063 26/124 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.