DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and zgc:174904

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001170922.1 Gene:zgc:174904 / 564690 ZFINID:ZDB-GENE-080204-76 Length:320 Species:Danio rerio


Alignment Length:252 Identity:58/252 - (23%)
Similarity:105/252 - (41%) Gaps:48/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 TTLQESLKKMPAELDARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQI 179
            ||..::.|:..:||:....::|.:::.|            |.::.:||..|:.:    |.|.:::
Zfish   100 TTELQTAKREKSELEKDKSELEKKKREL------------EKEKSELEKKKSEL----EKRKSEL 148

  Fly   180 EEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSR 244
            |:::..||:.|.::.:    |:.|.|.......|.........|          .|..|.  || 
Zfish   149 EKEKSELQKELLQLKD----KVTKCEVTPAPRTTPAPTTSPCPQ----------NWKHFN--GS- 196

  Fly   245 LFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLDD---KSYWLGINDLQSSNTYVS 306
             .|........|..:..:|:..||::|.|...||...|...|..   .::|.||:|.:..:.:..
Zfish   197 -CYFISVTTRSWTDSQTYCKRYGGHLAIILTAEEQTFIWDLLPRGYWNAFWFGISDEKVEDDWHW 260

  Fly   307 VASGREVEFLNWNAGEPNHGNEDENCVELIRSKM---------NDDPCHRKKHVICQ 354
            | .|.::....|..||||: :.||:|..:|::.:         .|.|||.....||:
Zfish   261 V-DGTKLVGGFWEDGEPNN-HIDEDCGYMIKTDVLTRVAIKSWYDAPCHMSLPWICE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 7/40 (18%)
NAT_SF <170..>229 CDD:302625 11/58 (19%)
CLECT 247..354 CDD:153057 31/118 (26%)
zgc:174904NP_001170922.1 CLECT_DC-SIGN_like 186..316 CDD:153060 37/146 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5368
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.