DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and lectin

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001188329.1 Gene:lectin / 560034 ZFINID:ZDB-GENE-070912-438 Length:152 Species:Danio rerio


Alignment Length:122 Identity:31/122 - (25%)
Similarity:64/122 - (52%) Gaps:9/122 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 KFERIGSRLF-YINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARL-DDKSYWLGINDLQ 299
            ::.|.|||.| |.:  ...:|.:|...|:.:||.:.::::..|.|.:.:.: :.:.:::|..|.:
Zfish    27 QWSRFGSRCFRYFS--VPVNWVTAERNCQLLGGNLVSVQNGMENDFLLSLIPNSERFFIGGYDGE 89

  Fly   300 SSNTYVSVASGREVEFLNWNAGEPNHGNEDENCVELIRSK---MNDDPCHRKKHVIC 353
            ....:. .:.|....:.||.:||||:.| .|:|:|:..:.   .|:.||..::..||
Zfish    90 DEENWF-WSEGSSFGYTNWCSGEPNNMN-TEHCLEINWTSDRCWNNLPCSTEQGYIC 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 26/111 (23%)
lectinNP_001188329.1 CLECT 34..146 CDD:153057 28/115 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.