DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and illr4

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001035129.1 Gene:illr4 / 559737 ZFINID:ZDB-GENE-050311-5 Length:259 Species:Danio rerio


Alignment Length:200 Identity:42/200 - (21%)
Similarity:78/200 - (39%) Gaps:31/200 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 NFEMRLAQIEEQQKLLQETLKKIPEDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKVFW 235
            ||:.:|..::|....|||.........|. :...|||....|.        |.....|.:.    
Zfish    72 NFQKKLQDLQEVHDALQENFTAFSAVLEH-IYNREQNLSRALN--------NSAQCPEDWQ---- 123

  Fly   236 PKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAISARLD--DKSYWLGINDL 298
               ...|...::.::.:..||..:.|.|...||::..|.:::|.:.:.::.:  ..|:|:|:.|.
Zfish   124 ---YHAGKCYYFSSNTNTLDWFKSRDACISDGGHLVIINNRDEQEFLMSKTNKYKGSFWIGLTDK 185

  Fly   299 QSSNTYVSVASGR-EVEFLNWNAGEP-------NHGNEDENCVELIRSKMN-----DDPCHRKKH 350
            .:...::.|.:.: ..:...||..||       |...|.|:|..:.::..|     |..|.....
Zfish   186 STEGQWLWVDNTKLSTDIRYWNGQEPDNWKGYRNEYTEGEDCARIEQNNWNINSWFDAFCTIAFR 250

  Fly   351 VICQT 355
            .||:|
Zfish   251 RICET 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625 13/57 (23%)
CLECT 247..354 CDD:153057 25/121 (21%)
illr4NP_001035129.1 CLECT_DC-SIGN_like 118..255 CDD:153060 28/143 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.