DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and lectin-28C

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001285727.1 Gene:lectin-28C / 53542 FlyBaseID:FBgn0040099 Length:265 Species:Drosophila melanogaster


Alignment Length:362 Identity:104/362 - (28%)
Similarity:157/362 - (43%) Gaps:100/362 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRLEKCIVYLLVACNLVESRAESTENSRSVCLLKDPPNQCGEFCLSVLQPLLDHIVKHQEQWNT 65
            ||:|:..:.|.::|..:..|.:...|..|.||.|:||.||||.|||..|.||:.||.:|||||.|
  Fly     1 MFQLKVLLYYAIIAIVINASPSGCEETDRVVCQLEDPRNQCGPFCLEALMPLIGHIAQHQEQWKT 65

  Fly    66 SEALWLNETQGKLDRIQTQLAAQALSLEESAQK-VPGDIKDRLDRMEHLQTTLQESLKKMPAELD 129
            .:   |.|.|.:...|:.::.:|..||.||.:| :..||::|.:|.|                  
  Fly    66 CK---LQEIQAQQRDIEKEIESQKTSLTESWKKIIAEDIENRTNRSE------------------ 109

  Fly   130 ARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIP 194
               :|||.|   |.|                                         |||.|..| 
  Fly   110 ---LKMEGQ---LSD-----------------------------------------LQEALTSI- 126

  Fly   195 EDFERKLQKLEQNQKDELTKLGAQQSANQVTLKEIYTKV-FWPKFERIGSRLFYINHKDAYDWQS 258
                                        ..:||.:..|: ...:|:|||||..:|......:|.|
  Fly   127 ----------------------------TTSLKNMSAKINILHRFKRIGSRYLHIEDIVQQNWTS 163

  Fly   259 AVDFCRDMGGYIAAIKDQEELDAISARLD-DKSYWLGINDLQSSNTYVSVASGREVEFLNWNAGE 322
            |:..|:.|||.:|:|.::.:.:||.::|. |.:|.:||:||.....::||:||:...||.||.||
  Fly   164 ALSACQKMGGNLASIINEADFNAIVSQLSKDNTYMIGISDLAEKGVFISVSSGKRAPFLKWNPGE 228

  Fly   323 PNHGNEDENCVELIRSKMNDDPCHRKKHVICQTDKEV 359
            |.:.:.|:.||.:....|....|......||:.::.|
  Fly   229 PLYEHVDQRCVSIHNGGMWVASCTSDFKYICEANENV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 35/112 (31%)
NAT_SF <170..>229 CDD:302625 7/58 (12%)
CLECT 247..354 CDD:153057 36/107 (34%)
lectin-28CNP_001285727.1 Mer2 <12..134 CDD:286200 55/218 (25%)
CLECT 160..260 CDD:153057 35/99 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4072
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.