DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and lectin-30A

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:359 Identity:79/359 - (22%)
Similarity:126/359 - (35%) Gaps:140/359 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFRLEKCIVYLLVACNLVESRAESTENSRSVCLLKDPPNQCGEFCLSVLQPLL-DHIVKHQEQWN 64
            ||:.  |.:.:::|....:..|..|||                       ||| |.:..:|:||.
  Fly     1 MFKY--CFICVILAWASRDVLANKTEN-----------------------PLLIDQVAINQQQWF 40

  Fly    65 TSEALWLNETQGKLDRIQTQLAAQALSLEESAQKVPGDIKDRLDRMEHLQTTLQESLKKMPAELD 129
            |..||..:|.|.|:.||:.       |:||                                   
  Fly    41 TFIALKESEMQQKIVRIER-------SIEE----------------------------------- 63

  Fly   130 ARLMKMENQQKTLGDQLENQINLTKESQQDQLEALKNAMPINFEMRLAQIEEQQKLLQETLKKIP 194
             |||.|::                           |.|..:|                       
  Fly    64 -RLMAMQS---------------------------KLAYALN----------------------- 77

  Fly   195 EDFERKLQKLEQNQKDE-LTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQS 258
                 :||.:..||..| |.||......|...            |:|:|:|.|||..::..:|..
  Fly    78 -----ELQTIMGNQSVETLEKLRISHRINPAL------------FQRMGTRRFYIEKENKQNWFG 125

  Fly   259 AVDFCRDMGGYIAAIKDQEELDAISARLDDKSYWLGINDLQSSNTYVSVASGREVEFLNWNAGEP 323
            |.:.||.:||:||.|:|::|.:.|.:|.....:|:.:|.:..:..:.|..:||...|..|...| 
  Fly   126 ASNTCRQLGGHIATIRDEQEFNEIFSRAPAGVFWIDMNAMFKNGLFASSLTGRSPPFFKWKKEE- 189

  Fly   324 NHGNEDENCVELIRSKMNDDPCHRKKHVICQTDK 357
             .||:.: ||.:...:|.::.|......|||.::
  Fly   190 -RGNKFD-CVNVYNKEMYNENCFNTHLFICQAEQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411 22/112 (20%)
NAT_SF <170..>229 CDD:302625 10/59 (17%)
CLECT 247..354 CDD:153057 30/106 (28%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4072
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.