DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and lectin-46Ca

DIOPT Version :9

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster


Alignment Length:132 Identity:35/132 - (26%)
Similarity:65/132 - (49%) Gaps:12/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 PKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDA----ISARLDDKSYWLGIN 296
            |....:..:.||:..| ..:|..|.:.|...|..:|.:...|:..|    :::::....:|.|.|
  Fly    35 PYLRELNGKCFYVGIK-KINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGN 98

  Fly   297 DLQSSNTYVSVASGREVEFL-NWNAGEPNHGNEDENCVELIRSKMN-----DDPCHRKKHVICQT 355
            ||||...:..::||:.|.:: :.|..||...:..::|:| ||.:.|     |..|..||:.||:.
  Fly    99 DLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLE-IRIRPNVTVVLDVNCQEKKYFICEQ 162

  Fly   356 DK 357
            ::
  Fly   163 NQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 ExsD <44..>156 CDD:293411
NAT_SF <170..>229 CDD:302625
CLECT 247..354 CDD:153057 32/116 (28%)
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 34/120 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.