DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24Db and lectin-46Ca

DIOPT Version :10

Sequence 1:NP_652641.1 Gene:lectin-24Db / 53550 FlyBaseID:FBgn0040102 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_652633.1 Gene:lectin-46Ca / 53523 FlyBaseID:FBgn0040093 Length:328 Species:Drosophila melanogaster


Alignment Length:132 Identity:35/132 - (26%)
Similarity:65/132 - (49%) Gaps:12/132 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 PKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDA----ISARLDDKSYWLGIN 296
            |....:..:.||:..| ..:|..|.:.|...|..:|.:...|:..|    :::::....:|.|.|
  Fly    35 PYLRELNGKCFYVGIK-KINWFGAQNNCLRKGLNLADVSTMEDFKAVVHYVTSQVGFDDFWFGGN 98

  Fly   297 DLQSSNTYVSVASGREVEFL-NWNAGEPNHGNEDENCVELIRSKMN-----DDPCHRKKHVICQT 355
            ||||...:..::||:.|.:: :.|..||...:..::|:| ||.:.|     |..|..||:.||:.
  Fly    99 DLQSEGRFKYISSGKLVRYMGDSNIVEPTQRSNLDDCLE-IRIRPNVTVVLDVNCQEKKYFICEQ 162

  Fly   356 DK 357
            ::
  Fly   163 NQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24DbNP_652641.1 IFT57 <64..215 CDD:463118
CLECT 247..354 CDD:153057 32/116 (28%)
lectin-46CaNP_652633.1 CLECT 43..162 CDD:153057 34/120 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.